PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.9810s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 290aa    MW: 31421.3 Da    PI: 6.8772
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.9810s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.66.7e-343286155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt+eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Araha.9810s0004.1.p 32 KPRLRWTTELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRL 86
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-322987IPR009057Homeodomain-like
PROSITE profilePS5129411.6462989IPR017930Myb domain
SuperFamilySSF466895.73E-173187IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-243287IPR006447Myb domain, plants
PfamPF002495.8E-83484IPR001005SANT/Myb domain
PfamPF143791.3E-23130179IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
LDGGHAAGDY HGPLDGTNLP GDACLVLTTD PKPRLRWTTE LHERFVDAVT QLGGPDKATP  60
KTIMRTMGVK GLTLYHLKSH LQKFRLGRQA GKESTENSKD VSCVGESQDT GSSSTSSLRM  120
VQQEQNEGYQ VTEALRAQME VQRKLHEQLE HGQVQRRLQL RIEAQGKYLQ SILEKACKAF  180
DEQAAAFAGL EAAREELSDL AIKVSNSSQG TTVPYFDATK MMMMPSLSEL AVAIDNKNNI  240
TTNCSVESSL TSVTNGSSIS AASMKKRQRG DNLGVGYEGG WIMPSSTIG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0503550.0AY050355.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds.
GenBankAY0884280.0AY088428.1 Arabidopsis thaliana clone 6626 mRNA, complete sequence.
GenBankAY0940460.0AY094046.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002883484.10.0myb family transcription factor
SwissprotQ9SAK53e-64APL_ARATH; Myb family transcription factor APL
TrEMBLD7L4840.0D7L484_ARALL; Myb family transcription factor
STRINGfgenesh1_pm.C_scaffold_30021260.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35152561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.20.0G2-like family protein